PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09412.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 928aa    MW: 105740 Da    PI: 7.8905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09412.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45e-11424468246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g+WTt+Ed+ ++ +v++ G ++W  Ia+ +g++Rt+ qc  r+q 
  mrna09412.1-v1.0-hybrid 424 GPWTTDEDKMILYLVQKNGVNDWINIAEAVGTNRTPFQCLARYQR 468
                              89*****************************************96 PP

2Myb_DNA-binding42.21.8e-13477520246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                WT++Ed +l  av+ +G ++W ++a+ ++ gRt+ qc +rw k
  mrna09412.1-v1.0-hybrid 477 REWTKDEDAQLSSAVEAFGERDWQSVASALN-GRTGTQCSNRWKK 520
                              68*****************************.***********98 PP

3Myb_DNA-binding44.63.3e-14530573246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g+WT+eEd++l+ a  ++G+++W++ a+ ++ gRt  qc++r+ +
  mrna09412.1-v1.0-hybrid 530 GKWTPEEDKRLIVAQMLFGSKNWNKTAQFVP-GRTQAQCRDRYVN 573
                              79*****************************.***********77 PP

4Myb_DNA-binding46.48.8e-15583625347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               WT+eEd +l++a+++ G   W+++a++++ +Rt+++c  rw  +
  mrna09412.1-v1.0-hybrid 583 EWTEEEDSRLIKAIEECGHC-WSKVAAYVP-NRTDNMCWRRWKVL 625
                              6*****************99.*********.***********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.854318417IPR017877Myb-like domain
SMARTSM007170.0064322419IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-10325341IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-10390429IPR009057Homeodomain-like
SuperFamilySSF466894.87E-18399467IPR009057Homeodomain-like
PROSITE profilePS5129412.26418470IPR017930Myb domain
SMARTSM007172.5E-10422472IPR001005SANT/Myb domain
CDDcd001672.85E-7425470No hitNo description
PfamPF139212.6E-13426487No hitNo description
Gene3DG3DSA:1.10.10.601.9E-14430478IPR009057Homeodomain-like
SuperFamilySSF466891.65E-19450525IPR009057Homeodomain-like
PROSITE profilePS5129420.341471526IPR017930Myb domain
SMARTSM007179.8E-14475524IPR001005SANT/Myb domain
CDDcd001671.73E-10478522No hitNo description
Gene3DG3DSA:1.10.10.601.9E-16479525IPR009057Homeodomain-like
PROSITE profilePS500909.663524575IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-15526576IPR009057Homeodomain-like
SuperFamilySSF466893.88E-25527622IPR009057Homeodomain-like
SMARTSM007176.8E-12528577IPR001005SANT/Myb domain
PfamPF002491.1E-13530573IPR001005SANT/Myb domain
CDDcd001672.47E-10531575No hitNo description
PROSITE profilePS5129423.037576630IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-15577624IPR009057Homeodomain-like
SMARTSM007173.7E-11580628IPR001005SANT/Myb domain
CDDcd001679.95E-11583626No hitNo description
PfamPF002491.3E-13583624IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 928 aa     Download sequence    Send to blast
MSPLAENDEI PYYDDDDDDE YDDGFNDDIE ALRRACMITG QDPDDVIAKN DQGKNPSIHQ  60
NDDDDIDVGP SSAPNSDSDS DFDEDLELLR KIKNQFSDNK PLSLKPLCTL LPPSVSDEEE  120
DDYQTLLAVR KRFAAYENDT QGKSAVQIDP PCKSVQETCN EVSGSEAHER FPYLVTYTEE  180
GKPSTSIEWN QSDSCKPSMS PTKSSGFPKS ALAFWDAIIK NRSCQKFLGS KLIQIKAKIE  240
ENNKLKQRVK ILRDFQAHCK RRTGEALSQK KDPCVQLILT KRPRVDSKAH DRAISALSYG  300
PEENSHVADY RKALTKFPVS LDRKNWSEAE KKDLQKGIRQ QFQEMVLQSS MDESSYSETR  360
HGDSDAIDNI LASIKDLEIT PYSIKEFLPK VNWEQLASMY VPGRSGGECE ARWLNWEDPL  420
VNHGPWTTDE DKMILYLVQK NGVNDWINIA EAVGTNRTPF QCLARYQRSL NASILKREWT  480
KDEDAQLSSA VEAFGERDWQ SVASALNGRT GTQCSNRWKK SLHPTRTRAG KWTPEEDKRL  540
IVAQMLFGSK NWNKTAQFVP GRTQAQCRDR YVNSLEPSLK WCEWTEEEDS RLIKAIEECG  600
HCWSKVAAYV PNRTDNMCWR RWKVLFPDEV PLLREEKKIR KTALIRNFVD REKERPALGP  660
NDFLLQDGTS RKSLTRKTGG LSRVPKKIKP RRHRNNAQLC SEEETGTSNS EVETYDDDDA  720
SKKRKKKNVL KPHQIRHKDN EPTGDCEAVA LVPKKIRPRR NRNSGQIPGV SHSEVRTCNG  780
DDAMKKKIRR HRRQKGTEPT GECKAIVPVS NEDDAPKEPT EKSCSDQIIG TSDEEKAISH  840
FLHESKKRKL EVADDETDNP VVASLGKKKY KKRHAQTTKR HAQIQEATIK SGKEQASSGD  900
DMTLNCFLRN RSKKRRESGR GDIQNFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-293926166155MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-293926166155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1721725KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301260.10.0PREDICTED: myb-like protein L
TrEMBLM5WEG40.0M5WEG4_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1